PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10031937m
Common NameCICLE_v10031937mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 358aa    MW: 39647.5 Da    PI: 7.8337
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10031937mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14e-331771155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprl+WtpeLH+rFv+av++LGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Ciclev10031937m 17 KPRLKWTPELHQRFVDAVNHLGGPDKATPKSLMRVMGIPGLTLYHLKSHLQKYRL 71
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0761474IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-311572IPR009057Homeodomain-like
SuperFamilySSF466891.02E-161672IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-231772IPR006447Myb domain, plants
PfamPF002499.5E-91970IPR001005SANT/Myb domain
PfamPF143791.3E-22117163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGLQNQNMNL VLSTDAKPRL KWTPELHQRF VDAVNHLGGP DKATPKSLMR VMGIPGLTLY  60
HLKSHLQKYR LGKSQHVEAC IDNKQVVEYK ETQSSSDGHV NRNISDGTLN QLNESLQIAQ  120
ALQVQMEVQR KLHEQIEVQR HLQLRIEAQG KYLQSVLKKA QETLAGYSSS SAGVELAKAE  180
LSQLVSMVSM GCPSSSVSEL TEAGTSSLKD FERKQIRSTI CSMESSLTSS ESSGRKEEKQ  240
PVNEIGDTDT CKSNKTTPEL QLMDIHIHPQ DKPCKARSSN QASGRKRRES TISDGFPDEQ  300
QTAKRLATQN EKCDDQLRNT GLVGRFDLNS QYQNESESGS KAIDLNCKGL DQLNGPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438708.10.0hypothetical protein CICLE_v10031937mg
RefseqXP_006483142.10.0PREDICTED: uncharacterized protein LOC102612487 isoform X4
TrEMBLV4SVN10.0V4SVN1_9R
STRINGVIT_01s0026g02550.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-83G2-like family protein